Lineage for d1gya__ (1gya -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 6996Protein CD2, first domain [48740] (2 species)
  7. 6997Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)
  8. 7002Domain d1gya__: 1gya - [19745]

Details for d1gya__

PDB Entry: 1gya (more details)

PDB Description: n-glycan and polypeptide nmr solution structures of the adhesion domain of human cd2

SCOP Domain Sequences for d1gya__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gya__ b.1.1.1 (-) CD2, first domain {Human (Homo sapiens)}
keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer

SCOP Domain Coordinates for d1gya__:

Click to download the PDB-style file with coordinates for d1gya__.
(The format of our PDB-style files is described here.)

Timeline for d1gya__: