SCOP 1.73: Domain d1gyaa_: 1gya A:

Lineage for d1gyaa_ (1gya A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein CD2, first domain [48740] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)

8. Domain d1gyaa_: 1gya A: [19745]
   complexed with man, nag

Details for d1gyaa_

PDB Entry: 1gya

PDB Description: n-glycan and polypeptide nmr solution structures of the adhesion domain of human cd2

PDB Compounds: (A:) human cd2

SCOP Domain Sequences for d1gyaa_:

Sequence; same for both SEQRES and ATOM records:

>d1gyaa_ b.1.1.1 (A:) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]}
keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer

Timeline for d1gyaa_:

• d1gyaa_ first appeared (with stable ids) in SCOP 1.55, called d1gya__
  
• d1gyaa_ was called d1gya__ in SCOP 1.71
  
• d1gyaa_ appears in SCOP 1.75
  
• d1gyaa_ appears in the current release, SCOPe 2.08