SCOPe 2.06: Domain d4fhbd1: 4fhb D:3-128

Lineage for d4fhbd1 (4fhb D:3-128)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d4fhbd1: 4fhb D:3-128 [196936]
   Other proteins in same PDB: d4fhba_, d4fhbd2
   automated match to d2xa3a_
   complexed with fol, nap

Details for d4fhbd1

PDB Entry: 4fhb, 2.8 Å

PDB Description: enhancing dhfr catalysis by binding of an allosteric regulator nanobody (nb179)

PDB Compounds: (D:) Nb179

SCOPe Domain Sequences for d4fhbd1:

Sequence, based on SEQRES records:

>d4fhbd1 b.1.1.1 (D:3-128) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqaggslrlsceasgrtfssyamgwfrqapgkerdfvaviswsgsntyyad
sakgrftisrdnakntvylqmnslkpedtaiyycaapgrphgsswslnkkgqgydywgqg
tqvtvs

Sequence, based on observed residues (ATOM records):

>d4fhbd1 b.1.1.1 (D:3-128) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqaggslrlsceasgrtfssyamgwfrqaperdfvaviswsgsntyyadsa
kgrftisrdnakntvylqmnslkpedtaiyycaapgrphgsswslnkkgqgydywgqgtq
vtvs

Timeline for d4fhbd1:

• d4fhbd1 first appeared in SCOPe 2.02, called d4fhbd_
  
• d4fhbd1 was called d4fhbd_ in SCOPe 2.05
  
• d4fhbd1 appears in SCOPe 2.07
  
• d4fhbd1 appears in the current release, SCOPe 2.08