Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein automated matches [190514] (10 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [195885] (3 PDB entries) |
Domain d4fgha_: 4fgh A: [196839] automated match to d3m08a_ complexed with 0u6, gol, nap |
PDB Entry: 4fgh (more details), 2.5 Å
SCOPe Domain Sequences for d4fgha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fgha_ c.71.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} mtlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrn vvltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrg dtffppytfedwevassvegkldekntiphtflhlirkklvpr
Timeline for d4fgha_: