SCOPe 2.08: Domain d4fgha1: 4fgh A:0-158

Lineage for d4fgha1 (4fgh A:0-158)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (12 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [195885] (5 PDB entries)

8. Domain d4fgha1: 4fgh A:0-158 [196839]
   Other proteins in same PDB: d4fgha2
   automated match to d3m08a_
   complexed with 0u6, gol, nap

Details for d4fgha1

PDB Entry: 4fgh, 2.5 Å

PDB Description: S. aureus dihydrofolate reductase co-crystallized with ethyl-DAP isobutenyl-dihydrophthalazine inhibitor

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4fgha1:

Sequence; same for both SEQRES and ATOM records:

>d4fgha1 c.71.1.1 (A:0-158) automated matches {Staphylococcus aureus [TaxId: 1280]}
mtlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrn
vvltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrg
dtffppytfedwevassvegkldekntiphtflhlirkk

Timeline for d4fgha1:

• d4fgha1 first appeared in SCOPe 2.02, called d4fgha_
  
• d4fgha1 appears in SCOPe 2.07