SCOPe 2.08: Domain d4joqa1: 4joq A:25-319

Lineage for d4joqa1 (4joq A:25-319)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:349102] [196798] (1 PDB entry)

8. Domain d4joqa1: 4joq A:25-319 [196799]
   Other proteins in same PDB: d4joqa2
   automated match to d1dbpa_
   complexed with act, edo

Details for d4joqa1

PDB Entry: 4joq, 1.9 Å

PDB Description: putative ribose abc transporter, periplasmic solute-binding protein from rhodobacter sphaeroides

PDB Compounds: (A:) ABC ribose transporter, periplasmic solute-binding protein

SCOPe Domain Sequences for d4joqa1:

Sequence; same for both SEQRES and ATOM records:

>d4joqa1 c.93.1.0 (A:25-319) automated matches {Rhodobacter sphaeroides [TaxId: 349102]}
aqekvgtigiaipsathgfmgglnfhaqdtikrlqevypqldfvlatagnagkmvndied
mvatrnisalvvlpfesepltspvqavkeagiwvtvvdrglsvegiedlyvagdnpgfgr
vageyfaqhlesgkkivvlrgipttldnerveaftaaiegsgievldmqhgnwnrddafn
vmqdflskypqidavwaadddmaigameaiaqagrteemwvmggagmkeiirriadgdpq
lpanvtyppaqistaieltalklvsstpvsgrfiigsqlvtpenaeqfyfpdspf

Timeline for d4joqa1:

• d4joqa1 first appeared in SCOPe 2.02, called d4joqa_
  
• d4joqa1 appears in SCOPe 2.07