Class a: All alpha proteins [46456] (284 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.5: Hemolysin expression modulating protein HHA [68989] (1 family) |
Family a.23.5.1: Hemolysin expression modulating protein HHA [68990] (2 proteins) |
Protein automated matches [196791] (1 species) not a true protein |
Species Salmonella enterica [TaxId:990282] [196792] (1 PDB entry) |
Domain d4icgd_: 4icg D: [196793] automated match to d1jw2a_ protein/DNA complex |
PDB Entry: 4icg (more details), 2.92 Å
SCOPe Domain Sequences for d4icgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4icgd_ a.23.5.1 (D:) automated matches {Salmonella enterica [TaxId: 990282]} pltktdylmrlrrcqtidtlervieknkyelsdnelavfysaadhrlaeltmnklydkip ssvwkfir
Timeline for d4icgd_: