PDB entry 4icg

View 4icg on RCSB PDB site
Description: N-terminal dimerization domain of H-NS in complex with Hha (Salmonella Typhimurium)
Class: DNA binding protein
Keywords: DNA binding protein, Hha
Deposited on 2012-12-10, released 2013-03-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: 0.283
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Global DNA-binding transcriptional dual regulator H-NS
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:990282]
  Gene: hns, STMUK_1724
  Database cross-references and differences (RAF-indexed):
  • Uniprot F5ZQZ4 (Start-45)
• Chain 'B':
  Compound: Global DNA-binding transcriptional dual regulator H-NS
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:990282]
  Gene: hns, STMUK_1724
  Database cross-references and differences (RAF-indexed):
  • Uniprot F5ZQZ4 (Start-45)
• Chain 'C':
  Compound: Hemolysin expression-modulating protein
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:990282]
  Gene: hha, STMUK_0480
  Database cross-references and differences (RAF-indexed):
  • Uniprot F5ZMH5 (Start-74)
  Domains in SCOPe 2.02: d4icgc_
• Chain 'D':
  Compound: Hemolysin expression-modulating protein
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:990282]
  Gene: hha, STMUK_0480
  Database cross-references and differences (RAF-indexed):
  • Uniprot F5ZMH5 (Start-74)
  Domains in SCOPe 2.02: d4icgd_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >4icgC (C:)
  gshmsdkpltktdylmrlrrcqtidtlervieknkyelsdnelavfysaadhrlaeltmn
  klydkipssvwkfir
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4icgC (C:)
  ltktdylmrlrrcqtidtlervieknkyelsdnelavfysaadhrlaeltmnklydkips
  svwkfir
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >4icgD (D:)
  gshmsdkpltktdylmrlrrcqtidtlervieknkyelsdnelavfysaadhrlaeltmn
  klydkipssvwkfir
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4icgD (D:)
  pltktdylmrlrrcqtidtlervieknkyelsdnelavfysaadhrlaeltmnklydkip
  ssvwkfir