Lineage for d4gh7c_ (4gh7 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804448Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 2804449Species Human (Homo sapiens) [TaxId:9606] [50836] (49 PDB entries)
  8. 2804556Domain d4gh7c_: 4gh7 C: [196774]
    automated match to d3dtqc_

Details for d4gh7c_

PDB Entry: 4gh7 (more details), 2.6 Å

PDB Description: crystal structure of anticalin n7a in complex with oncofetal fibronectin fragment fn7b8
PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d4gh7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gh7c_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfhgkwyvvgkagnhdlredkdprkmqatiyelkedksy
nvtnvrfvhkkcnyriwtfvpgsqpgeftlgnikswpgltswlvrvvstnynqhamvffk
rvyqnrelfeitlygrtkeltnelkenfirfskslglpenhivfpvpidqcidg

SCOPe Domain Coordinates for d4gh7c_:

Click to download the PDB-style file with coordinates for d4gh7c_.
(The format of our PDB-style files is described here.)

Timeline for d4gh7c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4gh7a_