SCOPe 2.05: Domain d3i8vb_: 3i8v B:

Lineage for d3i8vb_ (3i8v B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein automated matches [190370] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187208] (26 PDB entries)

8. Domain d3i8vb_: 3i8v B: [196548]
   automated match to d2qykb_
   complexed with 0mo, co, gol, mg, zn

Details for d3i8vb_

PDB Entry: 3i8v, 2.25 Å

PDB Description: Crystal structure of human PDE4a with 4-(3-butoxy-4-methoxyphenyl)methyl-2-imidazolidone

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4A

SCOPe Domain Sequences for d3i8vb_:

Sequence; same for both SEQRES and ATOM records:

>d3i8vb_ a.211.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mniprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkfr
ipvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalfa
aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskrq
rqslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvhc
adlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidyi
vhplwetwadlvhpdaqeildtlednrdwyysai

Timeline for d3i8vb_:

• d3i8vb_ first appeared in SCOPe 2.02
  
• d3i8vb_ appears in SCOPe 2.04
  
• d3i8vb_ is called d3i8vb1 in SCOPe 2.06
  
• d3i8vb_ appears in the current release, SCOPe 2.08, called d3i8vb1