Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein automated matches [190370] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries) |
Domain d3i8vb1: 3i8v B:290-622 [196548] Other proteins in same PDB: d3i8va2, d3i8vb2 automated match to d2qykb_ complexed with 0mo, co, gol, mg, zn |
PDB Entry: 3i8v (more details), 2.25 Å
SCOPe Domain Sequences for d3i8vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i8vb1 a.211.1.2 (B:290-622) automated matches {Human (Homo sapiens) [TaxId: 9606]} niprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkfri pvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalfaa aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskrqr qslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvhca dlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidyiv hplwetwadlvhpdaqeildtlednrdwyysai
Timeline for d3i8vb1: