Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (49 species) not a true protein |
Species Mycobacterium abscessus [TaxId:36809] [196288] (1 PDB entry) |
Domain d3swxc_: 3swx C: [196289] automated match to d3r9tb_ complexed with edo, gol |
PDB Entry: 3swx (more details), 2.1 Å
SCOPe Domain Sequences for d3swxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3swxc_ c.14.1.0 (C:) automated matches {Mycobacterium abscessus [TaxId: 36809]} dyetlrirrdgyvlviglnrpakrnafdktmleelalalgeyetdtdlraavlygegplf tagldlasvaaeiqggasltpegginpwqvdgrqlskpllvavhgkvltlgielalaadi viadetatfaqlevnrgiypfggatirfprtagwgnamrwmltadtfdaveahrigivqe ivpvgehvdtaiaiaqtiarqaplgvqatlrnarlavregdaaaeeqlvptvrelftsed atlgvqaflsrttaefvgr
Timeline for d3swxc_: