Lineage for d3swxc_ (3swx C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585428Species Mycobacterium abscessus [TaxId:36809] [196288] (1 PDB entry)
  8. 1585431Domain d3swxc_: 3swx C: [196289]
    automated match to d3r9tb_
    complexed with edo, gol

Details for d3swxc_

PDB Entry: 3swx (more details), 2.1 Å

PDB Description: crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus
PDB Compounds: (C:) Probable enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3swxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3swxc_ c.14.1.0 (C:) automated matches {Mycobacterium abscessus [TaxId: 36809]}
dyetlrirrdgyvlviglnrpakrnafdktmleelalalgeyetdtdlraavlygegplf
tagldlasvaaeiqggasltpegginpwqvdgrqlskpllvavhgkvltlgielalaadi
viadetatfaqlevnrgiypfggatirfprtagwgnamrwmltadtfdaveahrigivqe
ivpvgehvdtaiaiaqtiarqaplgvqatlrnarlavregdaaaeeqlvptvrelftsed
atlgvqaflsrttaefvgr

SCOPe Domain Coordinates for d3swxc_:

Click to download the PDB-style file with coordinates for d3swxc_.
(The format of our PDB-style files is described here.)

Timeline for d3swxc_: