Lineage for d3syxa1 (3syx A:13-127)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803479Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 2803506Protein Sprouty-related, EVH1 domain-containing protein 1, Spred-1 [141430] (2 species)
  7. 2803507Species Human (Homo sapiens) [TaxId:9606] [196261] (3 PDB entries)
  8. 2803508Domain d3syxa1: 3syx A:13-127 [196262]
    Other proteins in same PDB: d3syxa2
    automated match to d1xoda1
    complexed with yt3

Details for d3syxa1

PDB Entry: 3syx (more details), 2.45 Å

PDB Description: Crystal Structure of the WH1 domain from human sprouty-related, EVH1 domain-containing protein. Northeast Structural Genomics Consortium Target HR5538B.
PDB Compounds: (A:) Sprouty-related, EVH1 domain-containing protein 1

SCOPe Domain Sequences for d3syxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3syxa1 b.55.1.4 (A:13-127) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Human (Homo sapiens) [TaxId: 9606]}
syarvravvmtrddssggwlplggsglssvtvfkvphqeengcadffirgerlrdkmvvl
ecmlkkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraiedisqgc

SCOPe Domain Coordinates for d3syxa1:

Click to download the PDB-style file with coordinates for d3syxa1.
(The format of our PDB-style files is described here.)

Timeline for d3syxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3syxa2