SCOPe 2.08: Domain d3zwha_: 3zwh A:

Lineage for d3zwha_ (3zwh A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)

8. Domain d3zwha_: 3zwh A: [195645]
   automated match to d1m31a_
   complexed with act, azi, ca; mutant

Details for d3zwha_

PDB Entry: 3zwh, 1.94 Å

PDB Description: Ca2+-bound S100A4 C3S, C81S, C86S and F45W mutant complexed with myosin IIA

PDB Compounds: (A:) Protein S100-A4

SCOPe Domain Sequences for d3zwha_:

Sequence; same for both SEQRES and ATOM records:

>d3zwha_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asplekaldvmvstfhkysgkegdkfklnkselkelltrelpswlgkrtdeaafqklmsn
ldsnrdnevdfqeycvflssiammsneffegfp

Timeline for d3zwha_:

• d3zwha_ first appeared in SCOPe 2.02
  
• d3zwha_ appears in SCOPe 2.07