SCOPe 2.02: Domain d3u2ma_: 3u2m A:

Lineage for d3u2ma_ (3u2m A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)

6. Protein Augmenter of liver regeneration [89018] (2 species)
   a mammalian FAD-dependent sulfhydryl oxidase

7. Species Human (Homo sapiens) [TaxId:9606] [189907] (3 PDB entries)

8. Domain d3u2ma_: 3u2m A: [195211]
   automated match to d3o55a_
   complexed with fad; mutant

Details for d3u2ma_

PDB Entry: 3u2m, 2 Å

PDB Description: crystal structure of human alr mutant c142/145s

PDB Compounds: (A:) FAD-linked sulfhydryl oxidase ALR

SCOPe Domain Sequences for d3u2ma_:

Sequence; same for both SEQRES and ATOM records:

>d3u2ma_ a.24.15.1 (A:) Augmenter of liver regeneration {Human (Homo sapiens) [TaxId: 9606]}
fredcppdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskfypseesaedlr
krlarnhpdtrtraaftqwlchlhnevnrklgkpdfdcskvderwrdgwkdgscd

Timeline for d3u2ma_:

• d3u2ma_ is new in SCOPe 2.02-stable
  
• d3u2ma_ appears in SCOPe 2.03
  
• d3u2ma_ appears in the current release, SCOPe 2.08