Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) |
Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins) |
Protein Augmenter of liver regeneration [89018] (2 species) a mammalian FAD-dependent sulfhydryl oxidase |
Species Human (Homo sapiens) [TaxId:9606] [189907] (7 PDB entries) |
Domain d3u2ma_: 3u2m A: [195211] automated match to d3o55a_ complexed with fad; mutant |
PDB Entry: 3u2m (more details), 2 Å
SCOPe Domain Sequences for d3u2ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u2ma_ a.24.15.1 (A:) Augmenter of liver regeneration {Human (Homo sapiens) [TaxId: 9606]} fredcppdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskfypseesaedlr krlarnhpdtrtraaftqwlchlhnevnrklgkpdfdcskvderwrdgwkdgscd
Timeline for d3u2ma_: