Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (30 species) not a true protein |
Species Solanum tuberosum [TaxId:4113] [193294] (3 PDB entries) |
Domain d4gzja_: 4gzj A: [193295] automated match to d3em5a_ mutant |
PDB Entry: 4gzj (more details), 1.55 Å
SCOPe Domain Sequences for d4gzja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gzja_ c.1.8.0 (A:) automated matches {Solanum tuberosum [TaxId: 4113]} qpigvcygkiannlpsdqdviklynannikkmriyyphtnvfnalkgsnieiildvpnqd lealanpsnangwvqdnirnhfpdvkfkyiavgnevdpgresgkyarfvgpameniynal ssaglqnqikvststysglltntypprdsifreeyksfinpiigflarhnlpllaniypy fghidntnavplsyalfnqqrrndtgyqnlfdalvdsmyfateklggqnieiivsasgwp seghpaatlknartyytnlinhvkrgagtpkkpgktietylfamfdenekkgeasekhfg lfnpdqrpkyqlnfn
Timeline for d4gzja_: