Lineage for d4gzja_ (4gzj A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146973Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1146974Protein automated matches [190075] (30 species)
    not a true protein
  7. 1147061Species Solanum tuberosum [TaxId:4113] [193294] (3 PDB entries)
  8. 1147064Domain d4gzja_: 4gzj A: [193295]
    automated match to d3em5a_
    mutant

Details for d4gzja_

PDB Entry: 4gzj (more details), 1.55 Å

PDB Description: active-site mutant of potato endo-1,3-beta-glucanase in complex with laminaratriose and laminaratetrose
PDB Compounds: (A:) Glucan endo-1,3-beta-D-glucosidase

SCOPe Domain Sequences for d4gzja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gzja_ c.1.8.0 (A:) automated matches {Solanum tuberosum [TaxId: 4113]}
qpigvcygkiannlpsdqdviklynannikkmriyyphtnvfnalkgsnieiildvpnqd
lealanpsnangwvqdnirnhfpdvkfkyiavgnevdpgresgkyarfvgpameniynal
ssaglqnqikvststysglltntypprdsifreeyksfinpiigflarhnlpllaniypy
fghidntnavplsyalfnqqrrndtgyqnlfdalvdsmyfateklggqnieiivsasgwp
seghpaatlknartyytnlinhvkrgagtpkkpgktietylfamfdenekkgeasekhfg
lfnpdqrpkyqlnfn

SCOPe Domain Coordinates for d4gzja_:

Click to download the PDB-style file with coordinates for d4gzja_.
(The format of our PDB-style files is described here.)

Timeline for d4gzja_: