Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins) structural evidence for the gene duplication within the barrel fold |
Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species) |
Species Thermotoga maritima [TaxId:2336] [51371] (4 PDB entries) |
Domain d3zr4c_: 3zr4 C: [192812] Other proteins in same PDB: d3zr4f_ automated match to d1thfd_ complexed with gln, gol |
PDB Entry: 3zr4 (more details), 2.41 Å
SCOPe Domain Sequences for d3zr4c_:
Sequence, based on SEQRES records: (download)
>d3zr4c_ c.1.2.1 (C:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} mlakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey lkkhgvnvrlegl
>d3zr4c_ c.1.2.1 (C:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} mlakriiacldvkdgrvvkggdpvelgkfyseigidelvflditasvekrktmlelvekv aeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfgsqavvvai dakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksgydtemirf vrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeylkkhgvnvr legl
Timeline for d3zr4c_: