SCOPe 2.02: Domain d3zr4c_: 3zr4 C:

Lineage for d3zr4c_ (3zr4 C:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold

6. Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [51371] (4 PDB entries)

8. Domain d3zr4c_: 3zr4 C: [192812]
   Other proteins in same PDB: d3zr4f_
   automated match to d1thfd_
   complexed with gln, gol

Details for d3zr4c_

PDB Entry: 3zr4, 2.41 Å

PDB Description: structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex

PDB Compounds: (C:) Imidazole glycerol phosphate synthase subunit hisF

SCOPe Domain Sequences for d3zr4c_:

Sequence, based on SEQRES records:

>d3zr4c_ c.1.2.1 (C:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl

Sequence, based on observed residues (ATOM records):

>d3zr4c_ c.1.2.1 (C:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvkggdpvelgkfyseigidelvflditasvekrktmlelvekv
aeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfgsqavvvai
dakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksgydtemirf
vrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeylkkhgvnvr
legl

Timeline for d3zr4c_:

• d3zr4c_ is new in SCOPe 2.02-stable
  
• d3zr4c_ appears in SCOPe 2.03
  
• d3zr4c_ appears in the current release, SCOPe 2.08