Lineage for d3zr4c_ (3zr4 C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337251Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 1337252Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)
  7. 1337265Species Thermotoga maritima [TaxId:2336] [51371] (4 PDB entries)
  8. 1337269Domain d3zr4c_: 3zr4 C: [192812]
    Other proteins in same PDB: d3zr4b_, d3zr4d_, d3zr4f_
    automated match to d1thfd_
    complexed with gln, gol

Details for d3zr4c_

PDB Entry: 3zr4 (more details), 2.41 Å

PDB Description: structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex
PDB Compounds: (C:) Imidazole glycerol phosphate synthase subunit hisF

SCOPe Domain Sequences for d3zr4c_:

Sequence, based on SEQRES records: (download)

>d3zr4c_ c.1.2.1 (C:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl

Sequence, based on observed residues (ATOM records): (download)

>d3zr4c_ c.1.2.1 (C:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvkggdpvelgkfyseigidelvflditasvekrktmlelvekv
aeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfgsqavvvai
dakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksgydtemirf
vrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeylkkhgvnvr
legl

SCOPe Domain Coordinates for d3zr4c_:

Click to download the PDB-style file with coordinates for d3zr4c_.
(The format of our PDB-style files is described here.)

Timeline for d3zr4c_: