SCOPe 2.05: Domain d1fs2d1: 1fs2 D:80-146

Lineage for d1fs2d1 (1fs2 D:80-146)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries)

8. Domain d1fs2d1: 1fs2 D:80-146 [19273]
   Other proteins in same PDB: d1fs2a1, d1fs2a2, d1fs2b2, d1fs2c1, d1fs2c2, d1fs2d2

Details for d1fs2d1

PDB Entry: 1fs2, 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

PDB Compounds: (D:) skp1

SCOPe Domain Sequences for d1fs2d1:

Sequence; same for both SEQRES and ATOM records:

>d1fs2d1 a.157.1.1 (D:80-146) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
krtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktf
nikndft

Timeline for d1fs2d1:

• d1fs2d1 first appeared (with stable ids) in SCOP 1.55
  
• d1fs2d1 appears in SCOPe 2.04
  
• d1fs2d1 appears in SCOPe 2.06
  
• d1fs2d1 appears in the current release, SCOPe 2.08