Lineage for d1fs2d1 (1fs2 D:80-146)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735465Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2735466Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2735467Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2735474Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 2735475Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries)
  8. 2735489Domain d1fs2d1: 1fs2 D:80-146 [19273]
    Other proteins in same PDB: d1fs2a1, d1fs2a2, d1fs2b2, d1fs2c1, d1fs2c2, d1fs2d2

Details for d1fs2d1

PDB Entry: 1fs2 (more details), 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
PDB Compounds: (D:) skp1

SCOPe Domain Sequences for d1fs2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs2d1 a.157.1.1 (D:80-146) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
krtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktf
nikndft

SCOPe Domain Coordinates for d1fs2d1:

Click to download the PDB-style file with coordinates for d1fs2d1.
(The format of our PDB-style files is described here.)

Timeline for d1fs2d1: