Class a: All alpha proteins [46456] (285 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (29 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [187547] (2 PDB entries) |
Domain d2chpc_: 2chp C: [192686] automated match to d1ji5a_ complexed with po4 |
PDB Entry: 2chp (more details), 2 Å
SCOPe Domain Sequences for d2chpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chpc_ a.25.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} nqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaetvdtiaerl laiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfviglaeenqdn atadlfvglieevekqvwmlssylg
Timeline for d2chpc_: