PDB entry 2chp

View 2chp on RCSB PDB site
Description: crystal structure of the dodecameric ferritin mrga from b.subtilis 168
Class: DNA-binding protein
Keywords: DNA-binding protein, dps, dodecameric, ferritin, DNA-binding, stress protein
Deposited on 2006-03-16, released 2007-04-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metalloregulation DNA-binding stress protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2chpa_
  • Chain 'B':
    Compound: metalloregulation DNA-binding stress protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2chpb_
  • Chain 'C':
    Compound: metalloregulation DNA-binding stress protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2chpc_
  • Chain 'D':
    Compound: metalloregulation DNA-binding stress protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2chpd_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2chpA (A:)
    mktenaktnqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaet
    vdtiaerllaiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfvig
    laeenqdnatadlfvglieevekqvwmlssylg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chpA (A:)
    aktnqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaetvdtia
    erllaiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfviglaeen
    qdnatadlfvglieevekqvwmlssylg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2chpB (B:)
    mktenaktnqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaet
    vdtiaerllaiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfvig
    laeenqdnatadlfvglieevekqvwmlssylg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chpB (B:)
    ktnqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaetvdtiae
    rllaiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfviglaeenq
    dnatadlfvglieevekqvwmlssylg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2chpC (C:)
    mktenaktnqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaet
    vdtiaerllaiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfvig
    laeenqdnatadlfvglieevekqvwmlssylg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chpC (C:)
    nqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaetvdtiaerl
    laiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfviglaeenqdn
    atadlfvglieevekqvwmlssylg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2chpD (D:)
    mktenaktnqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaet
    vdtiaerllaiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfvig
    laeenqdnatadlfvglieevekqvwmlssylg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chpD (D:)
    nqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaetvdtiaerl
    laiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfviglaeenqdn
    atadlfvglieevekqvwmlssylg