Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins) automatically mapped to Pfam PF00426 |
Protein automated matches [190699] (4 species) not a true protein |
Species Porcine rotavirus [TaxId:31578] [189719] (3 PDB entries) |
Domain d3taya1: 3tay A:64-224 [192512] Other proteins in same PDB: d3taya2, d3tayb2 automated match to d2i2sa_ complexed with ben, epe, mn0, mpd, na, so4 |
PDB Entry: 3tay (more details), 1.85 Å
SCOPe Domain Sequences for d3taya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3taya1 b.29.1.14 (A:64-224) automated matches {Porcine rotavirus [TaxId: 31578]} lldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfg qqvtlsventsqtqwkfidvskttptgnytqhgslfstpklyavmkfsgriytyngttpn attgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl
Timeline for d3taya1: