SCOPe 2.02: Domain d4auua_: 4auu A:

Lineage for d4auua_ (4auu A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (1 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (14 PDB entries)

8. Domain d4auua_: 4auu A: [192297]
   automated match to d1uwfa1
   complexed with edo, ni, so4

Details for d4auua_

PDB Entry: 4auu, 1.6 Å

PDB Description: Crystal structure of apo FimH lectin domain at 1.5 A resolution

PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d4auua_:

Sequence; same for both SEQRES and ATOM records:

>d4auua_ b.2.3.2 (A:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4auua_:

• d4auua_ is new in SCOPe 2.02-stable
  
• d4auua_ appears in SCOPe 2.03
  
• d4auua_ appears in the current release, SCOPe 2.08