PDB entry 4auu

View 4auu on RCSB PDB site
Description: Crystal structure of apo FimH lectin domain at 1.5 A resolution
Class: cell adhesion
Keywords: cell adhesion, bacterial adhesin type 1 fimbriae, urinary tract infection, variable immunoglobulin fold
Deposited on 2012-05-22, released 2012-06-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.158
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4auua_
  • Chain 'B':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4auub_
  • Heterogens: NI, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4auuA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4auuB (B:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt