Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein I-kappa-B-alpha [48417] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48418] (2 PDB entries) |
Domain d1nfie_: 1nfi E: [19172] Other proteins in same PDB: d1nfia1, d1nfia2, d1nfib_, d1nfic1, d1nfic2, d1nfid_ applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1nfi (more details), 2.7 Å
SCOPe Domain Sequences for d1nfie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfie_ d.211.1.1 (E:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} ltedgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaea llgagcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhl asihgylgivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyq gyspyqltwgrpstriqqqlgqltlenlqmlpe
Timeline for d1nfie_: