SCOPe 2.08: Domain d1nfie_: 1nfi E:

Lineage for d1nfie_ (1nfi E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein I-kappa-B-alpha [48417] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48418] (2 PDB entries)

8. Domain d1nfie_: 1nfi E: [19172]
   Other proteins in same PDB: d1nfia1, d1nfia2, d1nfib_, d1nfic1, d1nfic2, d1nfid_
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1nfie_

PDB Entry: 1nfi, 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex

PDB Compounds: (E:) I-kappa-b-alpha

SCOPe Domain Sequences for d1nfie_:

Sequence; same for both SEQRES and ATOM records:

>d1nfie_ d.211.1.1 (E:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]}
ltedgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaea
llgagcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhl
asihgylgivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyq
gyspyqltwgrpstriqqqlgqltlenlqmlpe

Timeline for d1nfie_:

• d1nfie_ first appeared (with stable ids) in SCOP 1.55
  
• d1nfie_ appears in SCOPe 2.07