Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49249] (3 PDB entries) Uniprot P25799 245-350 |
Domain d1nfib_: 1nfi B: [21925] Other proteins in same PDB: d1nfia1, d1nfia2, d1nfic1, d1nfic2, d1nfie_, d1nfif_ |
PDB Entry: 1nfi (more details), 2.7 Å
SCOPe Domain Sequences for d1nfib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfib_ b.1.18.1 (B:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]} snlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhr qfaivfktpkykdinitkpasvfvqlrrksdletsepkpflyypeik
Timeline for d1nfib_: