SCOPe 2.01: Domain d2atjb_: 2atj B:

Lineage for d2atjb_ (2atj B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Plant peroxidase [48125] (6 species)

7. Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (28 PDB entries)

8. Domain d2atjb_: 2atj B: [18676]
   complexed with bho, ca, hem

Details for d2atjb_

PDB Entry: 2atj, 2 Å

PDB Description: recombinant horseradish peroxidase complex with benzhydroxamic acid

PDB Compounds: (B:) peroxidase c1a

SCOPe Domain Sequences for d2atjb_:

Sequence; same for both SEQRES and ATOM records:

>d2atjb_ a.93.1.1 (B:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntt
sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
plgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnlee
qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
ncrvvnsn

Timeline for d2atjb_:

• d2atjb_ first appeared (with stable ids) in SCOP 1.55
  
• d2atjb_ appears in SCOP 1.75
  
• d2atjb_ appears in SCOPe 2.02
  
• d2atjb_ appears in the current release, SCOPe 2.08