Lineage for d2atja_ (2atj A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919407Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 919408Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 919409Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 919611Protein Plant peroxidase [48125] (6 species)
  7. 919614Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (28 PDB entries)
  8. 919637Domain d2atja_: 2atj A: [18675]
    complexed with bho, ca, hem

Details for d2atja_

PDB Entry: 2atj (more details), 2 Å

PDB Description: recombinant horseradish peroxidase complex with benzhydroxamic acid
PDB Compounds: (A:) peroxidase c1a

SCOPe Domain Sequences for d2atja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atja_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntt
sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
plgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnlee
qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
ncrvvnsn

SCOPe Domain Coordinates for d2atja_:

Click to download the PDB-style file with coordinates for d2atja_.
(The format of our PDB-style files is described here.)

Timeline for d2atja_: