SCOPe 2.05: Domain d4aeaa_: 4aea A:

Lineage for d4aeaa_ (4aea A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein alpha-Cobratoxin [57318] (3 species)

7. Species Monocled cobra (Naja kaouthia) [TaxId:8649] [189877] (1 PDB entry)

8. Domain d4aeaa_: 4aea A: [186743]
   automated match to d1ctxa_
   complexed with gly, mpd

Details for d4aeaa_

PDB Entry: 4aea, 1.94 Å

PDB Description: Dimeric alpha-cobratoxin X-ray structure: Localization of intermolecular disulfides and possible mode of binding to nicotinic acetylcholine receptors

PDB Compounds: (A:) long neurotoxin 1

SCOPe Domain Sequences for d4aeaa_:

Sequence; same for both SEQRES and ATOM records:

>d4aeaa_ g.7.1.1 (A:) alpha-Cobratoxin {Monocled cobra (Naja kaouthia) [TaxId: 8649]}
ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
ncnpfpt

Timeline for d4aeaa_:

• d4aeaa_ first appeared in SCOPe 2.01
  
• d4aeaa_ appears in SCOPe 2.04
  
• d4aeaa_ appears in SCOPe 2.06
  
• d4aeaa_ appears in the current release, SCOPe 2.08