Lineage for d4aeaa_ (4aea A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702133Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1702134Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1702135Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 1702136Protein alpha-Cobratoxin [57318] (3 species)
  7. 1702145Species Monocled cobra (Naja kaouthia) [TaxId:8649] [189877] (1 PDB entry)
  8. 1702146Domain d4aeaa_: 4aea A: [186743]
    automated match to d1ctxa_
    complexed with gly, mpd

Details for d4aeaa_

PDB Entry: 4aea (more details), 1.94 Å

PDB Description: Dimeric alpha-cobratoxin X-ray structure: Localization of intermolecular disulfides and possible mode of binding to nicotinic acetylcholine receptors
PDB Compounds: (A:) long neurotoxin 1

SCOPe Domain Sequences for d4aeaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aeaa_ g.7.1.1 (A:) alpha-Cobratoxin {Monocled cobra (Naja kaouthia) [TaxId: 8649]}
ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
ncnpfpt

SCOPe Domain Coordinates for d4aeaa_:

Click to download the PDB-style file with coordinates for d4aeaa_.
(The format of our PDB-style files is described here.)

Timeline for d4aeaa_: