Lineage for d3uy4a_ (3uy4 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1160658Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1160659Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1161188Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1161189Protein automated matches [190459] (18 species)
    not a true protein
  7. 1161198Species Campylobacter jejuni [TaxId:192222] [189366] (3 PDB entries)
  8. 1161200Domain d3uy4a_: 3uy4 A: [186432]
    automated match to d1v8fa_
    complexed with amp, gol, pau

Details for d3uy4a_

PDB Entry: 3uy4 (more details), 1.85 Å

PDB Description: crystal structure of pantoate--beta-alanine ligase from campylobacter jejuni complexed with amp and vitamin b5
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3uy4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uy4a_ c.26.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
amqvitsvkeakqivkdwkshqlsigyvptmgflhdghlslvkhaktqdkvivsifvnpm
qfgpnedfssyprdlerdikmcqdngvdmvfipdatqmylknfstyvdmntitdklcgak
rpghfrgvctvltkffnilnpdivymgqkdaqqcvvvrhmvddlnfdlkiqicpiireed
glakssrnvylskeerkaslaisqsiflaeklvregekntskiiqamkdilekeklikid
yielvdfntmenienitdnvlgavaafvgktrlidnflvqglk

SCOPe Domain Coordinates for d3uy4a_:

Click to download the PDB-style file with coordinates for d3uy4a_.
(The format of our PDB-style files is described here.)

Timeline for d3uy4a_: