SCOPe 2.08: Domain d3uy4a1: 3uy4 A:1-282

Lineage for d3uy4a1 (3uy4 A:1-282)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [189366] (4 PDB entries)

8. Domain d3uy4a1: 3uy4 A:1-282 [186432]
   Other proteins in same PDB: d3uy4a2
   automated match to d1v8fa_
   complexed with amp, gol, pau

Details for d3uy4a1

PDB Entry: 3uy4, 1.85 Å

PDB Description: crystal structure of pantoate--beta-alanine ligase from campylobacter jejuni complexed with amp and vitamin b5

PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3uy4a1:

Sequence; same for both SEQRES and ATOM records:

>d3uy4a1 c.26.1.0 (A:1-282) automated matches {Campylobacter jejuni [TaxId: 192222]}
mqvitsvkeakqivkdwkshqlsigyvptmgflhdghlslvkhaktqdkvivsifvnpmq
fgpnedfssyprdlerdikmcqdngvdmvfipdatqmylknfstyvdmntitdklcgakr
pghfrgvctvltkffnilnpdivymgqkdaqqcvvvrhmvddlnfdlkiqicpiireedg
lakssrnvylskeerkaslaisqsiflaeklvregekntskiiqamkdilekeklikidy
ielvdfntmenienitdnvlgavaafvgktrlidnflvqglk

Timeline for d3uy4a1:

• d3uy4a1 first appeared in SCOPe 2.01, called d3uy4a_
  
• d3uy4a1 appears in SCOPe 2.07