Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (43 species) not a true protein |
Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries) |
Domain d3uh3b_: 3uh3 B: [186263] automated match to d1nxfa_ complexed with cmo, hem |
PDB Entry: 3uh3 (more details), 1.8 Å
SCOPe Domain Sequences for d3uh3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uh3b_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} svydaaaqltadvkkdlrdswkvigsdkkgngvavmttlfadnqetigyfkrlgdvsqgm andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv lasknfgdkyanawaklvavvqaal
Timeline for d3uh3b_: