Lineage for d3u8lb_ (3u8l B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819576Protein automated matches [190922] (2 species)
    not a true protein
  7. 2819577Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)
  8. 2819793Domain d3u8lb_: 3u8l B: [186143]
    automated match to d1uw6a_
    complexed with 09q, so4

Details for d3u8lb_

PDB Entry: 3u8l (more details), 2.32 Å

PDB Description: crystal structure of the acetylcholine binding protein (achbp) from lymnaea stagnalis in complex with ns3570 (1-(5-phenylpyridin-3-yl)-1, 4-diazepane)
PDB Compounds: (B:) acetylcholine-binding protein

SCOPe Domain Sequences for d3u8lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u8lb_ b.96.1.1 (B:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d3u8lb_:

Click to download the PDB-style file with coordinates for d3u8lb_.
(The format of our PDB-style files is described here.)

Timeline for d3u8lb_: