Lineage for d3t6ka_ (3t6k A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855906Species Chloroflexus aurantiacus [TaxId:324602] [189714] (1 PDB entry)
  8. 2855907Domain d3t6ka_: 3t6k A: [185664]
    automated match to d1mvoa_
    complexed with edo, so4

Details for d3t6ka_

PDB Entry: 3t6k (more details), 1.86 Å

PDB Description: crystal structure of a putative response regulator (caur_3799) from chloroflexus aurantiacus j-10-fl at 1.86 a resolution
PDB Compounds: (A:) Response regulator receiver

SCOPe Domain Sequences for d3t6ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6ka_ c.23.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}
kphtllivddddtvaemlelvlrgagyevrraasgeealqqiyknlpdalicdvllpgid
gytlckrvrqhpltktlpilmltaqgdisakiagfeagandylakpfepqelvyrvknil
ar

SCOPe Domain Coordinates for d3t6ka_:

Click to download the PDB-style file with coordinates for d3t6ka_.
(The format of our PDB-style files is described here.)

Timeline for d3t6ka_: