SCOPe 2.05: Domain d3t6em_: 3t6e M:

Lineage for d3t6em_ (3t6e M:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (7 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [187141] (7 PDB entries)

8. Domain d3t6em_: 3t6e M: [185661]
   Other proteins in same PDB: d3t6ec_, d3t6eh1, d3t6eh2
   automated match to d1dxrm_
   complexed with bcb, bpb, dga, fe2, gol, hec, hto, lda, mq9, ns5, so4, uq9

Details for d3t6em_

PDB Entry: 3t6e, 1.92 Å

PDB Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-94

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d3t6em_:

Sequence; same for both SEQRES and ATOM records:

>d3t6em_ f.26.1.1 (M:) automated matches {Blastochloris viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d3t6em_:

• d3t6em_ first appeared in SCOPe 2.01
  
• d3t6em_ appears in SCOPe 2.04
  
• d3t6em_ appears in SCOPe 2.06
  
• d3t6em_ appears in the current release, SCOPe 2.08