Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) |
Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [81485] (15 PDB entries) synonym: blastochloris viridis |
Domain d3t6eh1: 3t6e H:1-36 [200766] Other proteins in same PDB: d3t6ec_, d3t6eh2, d3t6el_, d3t6em_ automated match to d6prch2 complexed with bcb, bpb, dga, fe2, gol, hec, hto, lda, mq9, ns5, so4, uq9 |
PDB Entry: 3t6e (more details), 1.92 Å
SCOPe Domain Sequences for d3t6eh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t6eh1 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]} myhgalaqhldiaqlvwyaqwlviwtvvllylrred
Timeline for d3t6eh1: