Class b: All beta proteins [48724] (174 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
Protein automated matches [191109] (2 species) not a true protein |
Species Clostridium beijerinckii [TaxId:290402] [189152] (5 PDB entries) |
Domain d3so0c_: 3so0 C: [185454] automated match to d1npsa_ complexed with ca; mutant |
PDB Entry: 3so0 (more details), 1.93 Å
SCOPe Domain Sequences for d3so0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3so0c_ b.11.1.0 (C:) automated matches {Clostridium beijerinckii [TaxId: 290402]} avtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftgtk wtytsdtpwvgndandkmtsvkiy
Timeline for d3so0c_: