Lineage for d3so0c_ (3so0 C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 941691Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 941692Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 941803Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 941804Protein automated matches [191109] (2 species)
    not a true protein
  7. 941805Species Clostridium beijerinckii [TaxId:290402] [189152] (5 PDB entries)
  8. 941817Domain d3so0c_: 3so0 C: [185454]
    automated match to d1npsa_
    complexed with ca; mutant

Details for d3so0c_

PDB Entry: 3so0 (more details), 1.93 Å

PDB Description: Crystal structure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii
PDB Compounds: (C:) Clostrillin

SCOPe Domain Sequences for d3so0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3so0c_ b.11.1.0 (C:) automated matches {Clostridium beijerinckii [TaxId: 290402]}
avtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftgtk
wtytsdtpwvgndandkmtsvkiy

SCOPe Domain Coordinates for d3so0c_:

Click to download the PDB-style file with coordinates for d3so0c_.
(The format of our PDB-style files is described here.)

Timeline for d3so0c_: