Lineage for d1npsa_ (1nps A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 941691Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 941692Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 941693Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
  6. 941770Protein Protein S [49706] (1 species)
    duplication consists of two domains of this fold
  7. 941771Species Myxococcus xanthus [TaxId:34] [49707] (3 PDB entries)
  8. 941772Domain d1npsa_: 1nps A: [23622]
    N-terminal domain
    complexed with ca

Details for d1npsa_

PDB Entry: 1nps (more details), 1.8 Å

PDB Description: crystal structure of n-terminal domain of protein s
PDB Compounds: (A:) development-specific protein s

SCOPe Domain Sequences for d1npsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npsa_ b.11.1.1 (A:) Protein S {Myxococcus xanthus [TaxId: 34]}
anitvfynedfqgkqvdlppgnytraqlaalgienntissvkvppgvkailyqndgfagd
qievvanaeelgplnnnvssirvisvpv

SCOPe Domain Coordinates for d1npsa_:

Click to download the PDB-style file with coordinates for d1npsa_.
(The format of our PDB-style files is described here.)

Timeline for d1npsa_: