SCOPe 2.01: Domain d3sjod_: 3sjo D:

Lineage for d3sjod_ (3sjo D:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (9 species)

7. Species Human enterovirus 71 [TaxId:39054] [189720] (2 PDB entries)

8. Domain d3sjod_: 3sjo D: [185431]
   automated match to d1l1na_
   complexed with ag7

Details for d3sjod_

PDB Entry: 3sjo, 1.7 Å

PDB Description: structure of EV71 3C in complex with Rupintrivir (AG7088)

PDB Compounds: (D:) 3C protease

SCOPe Domain Sequences for d3sjod_:

Sequence; same for both SEQRES and ATOM records:

>d3sjod_ b.47.1.4 (D:) 3C cysteine protease (picornain 3C) {Human enterovirus 71 [TaxId: 39054]}
ldfalsllrrnirqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnvldavelv
deqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvvqyg
flnlsgkpthrtmmynfptkagqcggvvtsvgkvigihiggngrqgfcaglkrsyfase

Timeline for d3sjod_:

• d3sjod_ is new in SCOPe 2.01-stable
  
• d3sjod_ appears in SCOPe 2.02
  
• d3sjod_ appears in the current release, SCOPe 2.08