SCOPe 2.05: Domain d3shua_: 3shu A:

Lineage for d3shua_ (3shu A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (84 PDB entries)

8. Domain d3shua_: 3shu A: [185405]
   automated match to d1tq3a1

Details for d3shua_

PDB Entry: 3shu, 2.75 Å

PDB Description: Crystal structure of ZO-1 PDZ3

PDB Compounds: (A:) Tight junction protein ZO-1

SCOPe Domain Sequences for d3shua_:

Sequence; same for both SEQRES and ATOM records:

>d3shua_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpgsmklvkfrkgdsvglrlaggndvgifvagvledspaakegleegdqilrvnnvdftn
iireeavlflldlpkgeevtilaqkkkdvyrriv

Timeline for d3shua_:

• d3shua_ first appeared in SCOPe 2.01
  
• d3shua_ appears in SCOPe 2.04
  
• d3shua_ is called d3shua1 in SCOPe 2.06
  
• d3shua_ appears in the current release, SCOPe 2.08, called d3shua1