Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (26 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189981] (1 PDB entry) |
Domain d3s4ka_: 3s4k A: [185270] automated match to d1q4sa_ complexed with cl, edo, so4 |
PDB Entry: 3s4k (more details), 1.7 Å
SCOPe Domain Sequences for d3s4ka_:
Sequence, based on SEQRES records: (download)
>d3s4ka_ d.38.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} vpfdselglqftelgpdgaraqldvrpkllqltgvvhggvycamiesiasmaafawlnsh geggsvvgvnnntdfvrsissgmvygtaeplhrgrrqqlwlvtitddtdrvvargqvrlq nlearp
>d3s4ka_ d.38.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} vpfdselglqftelgpdgaraqldvrpkllqltgvvhggvycamiesiasmaafawlnse ggsvvgvnnntdfvrsissgmvygtaeplhrgrrqqlwlvtitddtdrvvargqvrlqnl earp
Timeline for d3s4ka_: