Lineage for d3s4ka_ (3s4k A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023831Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1023832Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1024316Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1024317Protein automated matches [190143] (7 species)
    not a true protein
  7. 1024349Species Mycobacterium tuberculosis [TaxId:1773] [189981] (1 PDB entry)
  8. 1024350Domain d3s4ka_: 3s4k A: [185270]
    automated match to d1q4sa_
    complexed with cl, edo, so4

Details for d3s4ka_

PDB Entry: 3s4k (more details), 1.7 Å

PDB Description: structure of a putative esterase rv1847/mt1895 from mycobacterium tuberculosis
PDB Compounds: (A:) Putative esterase Rv1847/MT1895

SCOPe Domain Sequences for d3s4ka_:

Sequence, based on SEQRES records: (download)

>d3s4ka_ d.38.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vpfdselglqftelgpdgaraqldvrpkllqltgvvhggvycamiesiasmaafawlnsh
geggsvvgvnnntdfvrsissgmvygtaeplhrgrrqqlwlvtitddtdrvvargqvrlq
nlearp

Sequence, based on observed residues (ATOM records): (download)

>d3s4ka_ d.38.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vpfdselglqftelgpdgaraqldvrpkllqltgvvhggvycamiesiasmaafawlnse
ggsvvgvnnntdfvrsissgmvygtaeplhrgrrqqlwlvtitddtdrvvargqvrlqnl
earp

SCOPe Domain Coordinates for d3s4ka_:

Click to download the PDB-style file with coordinates for d3s4ka_.
(The format of our PDB-style files is described here.)

Timeline for d3s4ka_: