Lineage for d1foec1 (1foe C:1036-1239)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215745Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 215746Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 215747Family a.87.1.1: DBL homology domain (DH-domain) [48066] (6 proteins)
  6. 215765Protein GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) [48073] (1 species)
  7. 215766Species Mouse (Mus musculus) [TaxId:10090] [48074] (1 PDB entry)
  8. 215768Domain d1foec1: 1foe C:1036-1239 [18518]
    Other proteins in same PDB: d1foea2, d1foeb_, d1foec2, d1foed_, d1foee2, d1foef_, d1foeg2, d1foeh_

Details for d1foec1

PDB Entry: 1foe (more details), 2.8 Å

PDB Description: crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1

SCOP Domain Sequences for d1foec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foec1 a.87.1.1 (C:1036-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) {Mouse (Mus musculus)}
sdadklrkvicelletertyvkdlnclmerylkplqketfltqdeldvlfgnltemvefq
veflktledgvrlvpdleklekvdqfkkvlfslggsflyyadrfklysafcashtkvpkv
lvkaktdtafkafldaqnprqqhsstlesylikpiqrvlkyplllrelfaltdaeseehy
hldvaiktmnkvashinemqkihe

SCOP Domain Coordinates for d1foec1:

Click to download the PDB-style file with coordinates for d1foec1.
(The format of our PDB-style files is described here.)

Timeline for d1foec1: