Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [46475] (1 PDB entry) |
Domain d3rgka_: 3rgk A: [184952] automated match to d2mm1a_ complexed with hem, so4; mutant |
PDB Entry: 3rgk (more details), 1.65 Å
SCOPe Domain Sequences for d3rgka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rgka_ a.1.1.2 (A:) Myoglobin {Human (Homo sapiens) [TaxId: 9606]} glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp gdfgadaqgamnkalelfrkdmasnykel
Timeline for d3rgka_: