SCOPe 2.06: Domain d3rgka_: 3rgk A:

Lineage for d3rgka_ (3rgk A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46475] (1 PDB entry)

8. Domain d3rgka_: 3rgk A: [184952]
   automated match to d2mm1a_
   complexed with hem, so4; mutant

Details for d3rgka_

PDB Entry: 3rgk, 1.65 Å

PDB Description: Crystal Structure of Human Myoglobin Mutant K45R

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3rgka_:

Sequence; same for both SEQRES and ATOM records:

>d3rgka_ a.1.1.2 (A:) Myoglobin {Human (Homo sapiens) [TaxId: 9606]}
glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamnkalelfrkdmasnykel

Timeline for d3rgka_:

• d3rgka_ first appeared in SCOPe 2.01
  
• d3rgka_ appears in SCOPe 2.05
  
• d3rgka_ appears in SCOPe 2.07
  
• d3rgka_ appears in the current release, SCOPe 2.08