SCOPe 2.02: Domain d3r69b_: 3r69 B:

Lineage for d3r69b_ (3r69 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189959] (5 PDB entries)

8. Domain d3r69b_: 3r69 B: [184816]
   automated match to d1gq5a_
   complexed with cit

Details for d3r69b_

PDB Entry: 3r69, 1.5 Å

PDB Description: molecular analysis of the interaction of the hdl-receptor sr-bi with the pdz3 domain of its adaptor protein pdzk1

PDB Compounds: (B:) Na(+)/H(+) exchange regulatory cofactor NHE-RF3, Scavenger receptor class B member 1

SCOPe Domain Sequences for d3r69b_:

Sequence, based on SEQRES records:

>d3r69b_ b.36.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsprvvvikkgsngygfylragpeqkgqiikdiepgspaeaaglknndlvvavngksvea
ldhdgvvemirkggdqttllvldkqeakl

Sequence, based on observed residues (ATOM records):

>d3r69b_ b.36.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsprvvvikkgsngygfylragpegqiikdiepgspaeaaglknndlvvavngksveald
hdgvvemirkggdqttllvldkqeakl

Timeline for d3r69b_:

• d3r69b_ first appeared in SCOPe 2.01
  
• d3r69b_ appears in SCOPe 2.03
  
• d3r69b_ appears in the current release, SCOPe 2.08, called d3r69b1